General Information

  • ID:  hor002942
  • Uniprot ID:  P85799
  • Protein name:  Brain peptide GYPYQHRLVY
  • Gene name:  NA
  • Organism:  Apis mellifera (Honeybee)
  • Family:  NA
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Apis (genus), Apini (tribe), Apinae (subfamily), Apidae (family), Apoidea (superfamily), Aculeata (infraorder), Apocrita (suborder), Hymenoptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GYPYQHRLVY
  • Length:  10
  • Propeptide:  MMCDWVWLLLTLCSLLMIVQSLPTNLAEDTKKTEQTMRPKSKRAQEMLMFGNQQNHQPENNPSSSYSSTAEKRTLAASGLGGLKAALIEEEKPSRSNTLNNAFYDRKNYDYGAVNELGYEIPQVWDNSPYSRYYTNEDRRKRSEKSAVASGSSTTIKPSTTSFQSPTSTQQSVQTQVKRNVPIYQEPRFKRELDIDPEDVLTLLSLWENERRKRNWHKYMNEEYENVDDEDNLLEEEDSRNIIPWMDSSVYPPRHYSLDSLSPSDIGIIRTHPSSYYEQYENQYGQQYDTSQYGSPQYGLVYPQQTYYSAPEKRFMISRKRSQAYDPYSNAAQFQLSSQSRGYPYQHRLVY
  • Signal peptide:  MMCDWVWLLLTLCSLLMIVQS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q566V9-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-Q566V9-F1.pdbhor002942_AF2.pdbhor002942_ESM.pdb

Physical Information

Mass: 145617 Formula: C62H86N16O15
Absent amino acids: ACDEFIKMNSTW Common amino acids: Y
pI: 9.07 Basic residues: 2
Polar residues: 4 Hydrophobic residues: 2
Hydrophobicity: -91 Boman Index: -1564
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 68
Instability Index: 531 Extinction Coefficient cystines: 4470
Absorbance 280nm: 496.67

Literature

  • PubMed ID:  19576913
  • Title:  Mass Spectrometric Profiling of (Neuro)-Peptides in the Worker Honeybee, Apis Mellifera.
  • PubMed ID:  17068263
  • Title:  From the Genome to the Proteome: Uncovering Peptides in the Apis Brain